Bifidobacterium aquikefiricola: QN215_06740 Help Entry QN215_06740       CDS       T10738                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism baqk  Bifidobacterium aquikefiricola Brite KEGG Orthology (KO) [BR:baqk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:baqk03032]     QN215_06740    03036 Chromosome and associated proteins [BR:baqk03036]     QN215_06740    03400 DNA repair and recombination proteins [BR:baqk03400]     QN215_06740 DNA replication proteins [BR:baqk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QN215_06740 Chromosome and associated proteins [BR:baqk03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QN215_06740 DNA repair and recombination proteins [BR:baqk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QN215_06740 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  XDS43969 UniProt:  A0AB39U4L3 LinkDB All DBs Position 1580790..1581071 Genome browser AA seq 93 aa AA seqDB search MAYNKSDLVSKIAQKSNLTKAQSEAAINAFQDIFVESLQSGEGLRLTGLFSAERVKRAAR TGRNPRTGETIKIPASYGVRISAGSLLKKAVTK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcatacaacaagtctgatctcgtctcaaagattgcacagaagtcgaacctgaccaag gctcagtccgaggcagcaatcaacgcatttcaggatatttttgtagagtccctccagtca ggcgaaggcctgagacttacgggtcttttctcggcagagcgcgtcaagcgtgctgctcgc accggccgcaacccacgaaccggcgaaaccatcaagattccagcaagctacggcgttcgt atcagcgctggctcactgctgaagaaggcagtaaccaagtaa

DBGET integrated database retrieval system