Bartonella sp. A1379B: BA1379B_007170 Help Entry BA1379B_007170    CDS       T05185                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bara  Bartonella sp. A1379B Pathway bara01100   Metabolic pathways bara01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bara00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BA1379B_007170    00074 Mycolic acid biosynthesis     BA1379B_007170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BA1379B_007170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AQX18541 UniProt:  A0AAC9QMS0 LinkDB All DBs Position complement(830987..831223) Genome browser AA seq 78 aa AA seqDB search MSDTEERVRKIIVEHLGVDADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDNAA ETIFTVGDAVKFIDKASL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagaagagcgcgttaggaagattatcgtagagcatctcggagttgacgca gataaggtcgtagaaaatgctagcttcatcgatgatctaggagcagatagccttgatacg gttgaacttgtgatggcttttgaagaagagtttggtatagaaattccggataatgctgct gagacaatcttcacagttggtgacgcagtgaagtttattgataaagcttctctataa

DBGET integrated database retrieval system