Candidatus Bathyarchaeota archaeon BA1: AOA65_1094 Help Entry AOA65_1094        CDS       T04065                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism barc  Candidatus Bathyarchaeota archaeon BA1 Pathway barc03010   Ribosome Brite KEGG Orthology (KO) [BR:barc00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AOA65_1094   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AOA65_1094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:barc03011]     AOA65_1094    04121 Ubiquitin system [BR:barc04121]     AOA65_1094   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:barc04147]     AOA65_1094 Ribosome [BR:barc03011]  Ribosomal proteins   Eukaryotes    Small subunit     AOA65_1094   Archaea     AOA65_1094 Ubiquitin system [BR:barc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AOA65_1094 Exosome [BR:barc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AOA65_1094   Exosomal proteins of colorectal cancer cells    AOA65_1094 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Ephrin_rec_like Zn_ribbon_Nudix Motif Other DBs NCBI-ProteinID:  KPV64064 UniProt:  A0A0P9E6T2 LinkDB All DBs AA seq 68 aa AA seqDB search MAEKPKEVKAKKKEKPLSSRYKIEGGKLVRLLPLCERCGPGYFMADHGDRYTCGHCGFTR YKRTEASK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggctgaaaaacccaaggaggtgaaggccaaaaagaaggagaagcctctttcctcccgt tataaaattgagggaggtaagcttgtaaggctgctccccttgtgcgagcgatgtggacca ggctacttcatggcagatcacggcgatcgatacacttgtgggcactgcggcttcacacga tacaagcgaactgaagccagtaaataa

DBGET integrated database retrieval system