Bradyrhizobium arachidis: WN72_10785 Help Entry WN72_10785        CDS       T06898                                  Name (GenBank) hypothetical protein   KO K04078   chaperonin GroES Organism barh  Bradyrhizobium arachidis Brite KEGG Orthology (KO) [BR:barh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:barh03110]     WN72_10785    03029 Mitochondrial biogenesis [BR:barh03029]     WN72_10785 Chaperones and folding catalysts [BR:barh03110]  Heat shock proteins   HSP10    WN72_10785 Mitochondrial biogenesis [BR:barh03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     WN72_10785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QOZ66754 UniProt:  A0AAE7NQD5 LinkDB All DBs Position complement(2235154..2235324) Genome browser AA seq 56 aa AA seqDB search MNFRPLPDRVVVKRTDADKNTACAVIIPDTAKEKLQAWVVQLIIGLTLAIIGLVTM NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaattttcgtccgcttcccgaccgcgtcgtggtcaagcgcaccgacgccgataagaat accgcttgcgccgttatcattcccgacacagccaaggaaaagctgcaggcatgggtcgtt cagctcattattggcctgacccttgctataattggacttgtcacaatgtga

DBGET integrated database retrieval system