Bradyrhizobium arachidis: WN72_13770
Help
Entry
WN72_13770 CDS
T06898
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adapter protein ClpS 1
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
barh
Bradyrhizobium arachidis
Brite
KEGG Orthology (KO) [BR:
barh00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
WN72_13770 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Lipase_3
Motif
Other DBs
NCBI-ProteinID:
QOZ67258
UniProt:
A0AAE7NJP5
LinkDB
All DBs
Position
complement(2866909..2867214)
Genome browser
AA seq
101 aa
AA seq
DB search
MNDTVTKPKTRTKTKVERPKLHKVILINDDYTPREFVTMVLKAEFRMTEDQAYKVMITAH
KLGACVVAVFTKDVAETKATRATDAGRAKGYPLLFTTEPEE
NT seq
306 nt
NT seq
+upstream
nt +downstream
nt
atgaacgacaccgttaccaagccgaaaaccagaaccaagaccaaggtcgagcggccgaag
ctgcacaaggtcatcctgatcaacgacgactacacgccgcgcgaattcgtcaccatggtg
ctgaaggccgaattccgcatgacagaggatcaggcctacaaggtgatgatcactgcccac
aagctcggcgcctgcgtggtcgccgtgttcaccaaggacgtcgccgagaccaaggcgacg
cgtgccaccgacgccggccgcgccaagggctatccgctgctgttcaccacggagccggag
gaataa
DBGET
integrated database retrieval system