Bradyrhizobium arachidis: WN72_33000 Help Entry WN72_33000        CDS       T06898                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism barh  Bradyrhizobium arachidis Pathway barh00362   Benzoate degradation barh00621   Dioxin degradation barh00622   Xylene degradation barh01100   Metabolic pathways barh01120   Microbial metabolism in diverse environments barh01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:barh00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     WN72_33000    00622 Xylene degradation     WN72_33000    00621 Dioxin degradation     WN72_33000 Enzymes [BR:barh01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      WN72_33000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QOZ70589 UniProt:  A0AAE7NRB4 LinkDB All DBs Position 6884217..6884453 Genome browser AA seq 78 aa AA seqDB search MPIVTIQVTREGTMAGAASLTAEEKAVLIKGSSELLRDVLGKPLESTFVVIEEVDTDNWG WGGLPALEFRRRRAAQAG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcctatcgtcaccattcaagtgacccgcgaaggaacgatggcgggcgcggcgtcgctc accgcggaggagaaggcggtgctgatcaagggctcgagcgagctcctgcgcgacgtgctc ggcaagccgctcgaatccacattcgtcgtgatcgaggaagtcgacaccgacaattggggc tggggcggcctgcccgcgctggaattccggcgccgccgcgcagcccaggccggatga

DBGET integrated database retrieval system