Burkholderia arboris: NLX30_01150 Help Entry NLX30_01150       CDS       T08608                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bari  Burkholderia arboris Brite KEGG Orthology (KO) [BR:bari00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bari03036]     NLX30_01150    03400 DNA repair and recombination proteins [BR:bari03400]     NLX30_01150 Chromosome and associated proteins [BR:bari03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     NLX30_01150 DNA repair and recombination proteins [BR:bari03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       NLX30_01150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  UTV56556 LinkDB All DBs Position 248786..249079 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcaaagtcgcgtgaatacgctgaagtgctgaatgacgtgaagcagaaaattgccgactat ggcttttcgctcgccgaactcggtctcagccgcgcgaaggcaggtaaggttggccgtccg cgcgcaggcgtggccgcgaagtaccgcgatccggaaacgggcgcaacgtggtcgggccgc ggcaagccgccgcgctggattgccggcaagaaccgcgaacagtttgcgatttaa

DBGET integrated database retrieval system