Babylonia areolata (ivory shell): 143274718 Help Entry 143274718         CDS       T11321                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism barl  Babylonia areolata (ivory shell) Pathway barl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:barl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     143274718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:barl04121]     143274718    03400 DNA repair and recombination proteins [BR:barl03400]     143274718 Ubiquitin system [BR:barl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      143274718    Cul5 complex      143274718 DNA repair and recombination proteins [BR:barl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      143274718 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  143274718 NCBI-ProteinID:  XP_076434739 LinkDB All DBs Position 29:2344985..2351845 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRMKTTIFTDAKETTSLIDVKRIVEGITKVPPENQRLFREDQALTDDNKCLGD YGLNTNNAKAQSPATLGLTYKKEDGEWEQLDIQPLSSPPELPDVMKPQETSQQVEQAAA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcctaatgattcgccgcatgaaaaccaccattttcactgatgcgaaggaa acgacatccctcattgatgtcaaacggatcgtcgagggcatcaccaaagttccaccagag aaccagcgcctgtttagggaggatcaggctctgactgacgacaacaagtgcttgggggac tatggtttgaacacgaacaatgccaaggcccagtcccctgctaccctgggactgacctac aagaaggaagacggtgaatgggagcagttggacattcagcctctgtccagtccaccagag ctgccagatgttatgaaacctcaggagacatcccagcaagtggaacaagcagctgcctga

DBGET integrated database retrieval system