Babylonia areolata (ivory shell): 143282670
Help
Entry
143282670 CDS
T11321
Name
(RefSeq) superoxide dismutase [Cu-Zn]-like
KO
K04565
superoxide dismutase, Cu-Zn family [EC:
1.15.1.1
]
Organism
barl Babylonia areolata (ivory shell)
Pathway
barl04146
Peroxisome
Brite
KEGG Orthology (KO) [BR:
barl00001
]
09140 Cellular Processes
09141 Transport and catabolism
04146 Peroxisome
143282670
Enzymes [BR:
barl01000
]
1. Oxidoreductases
1.15 Acting on superoxide as acceptor
1.15.1 Acting on superoxide as acceptor (only sub-subclass identified to date)
1.15.1.1 superoxide dismutase
143282670
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sod_Cu
Motif
Other DBs
NCBI-GeneID:
143282670
NCBI-ProteinID:
XP_076444454
LinkDB
All DBs
Position
6:complement(4425078..4444069)
Genome browser
AA seq
152 aa
AA seq
DB search
MAKAICVLSGSTEVKGELIFTQEGDSPTKVQGEVRGLTQGDHGFHIHQFGDVSNGCASAG
SHFNPQEKKHGGPTDTERHAGDLGNIVANEDGTAKVDITDAQIPLSGPNSIIGRCLVVHA
GKDDLGKGGDDESLKTGNAGARVACGIIGITK
NT seq
459 nt
NT seq
+upstream
nt +downstream
nt
atggcgaaagcaatctgtgttttgtccggtagcacggaagtcaaaggagagctgatcttc
acacaggagggggacagtcccaccaaagtgcagggtgaggtgagaggattgacacaaggt
gaccatggcttccacatccatcagtttggagacgtctccaatggttgtgcatcagcaggg
tcccacttcaaccctcaagagaaaaaacatggaggccccactgacactgaaaggcatgct
ggagacctggggaatattgtggccaatgaggatggcactgccaaagttgatatcaccgat
gctcagattcctctttcggggccaaattccattattggaagatgtctggttgtgcatgct
ggtaaggatgaccttggcaagggaggcgatgatgaaagtctgaagacaggcaatgctggg
gcgcgtgtggcctgcggaatcattggcatcaccaagtga
DBGET
integrated database retrieval system