Bartonella sp. 1-1C: B11Cv2_007910 Help Entry B11Cv2_007910     CDS       T05463                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism baro  Bartonella sp. 1-1C Pathway baro01100   Metabolic pathways baro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:baro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B11Cv2_007910    00074 Mycolic acid biosynthesis     B11Cv2_007910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B11Cv2_007910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ATO57552 LinkDB All DBs Position complement(891408..891644) Genome browser AA seq 78 aa AA seqDB search MSDTEERVRKIIVEHLGVDADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIFTVGDAVKFIDKASV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagaagagcgcgttagaaagattatcgtagagcatctcggagttgacgca gataaggtcgtagaaaatgcaagcttcatcgatgatttaggagcagatagccttgatacg gttgaacttgtgatggcttttgaagaagagtttggtatagaaattccggatgatgctgct gagacaatcttcacagttggtgacgcagtgaagtttattgataaagcttctgtataa

DBGET integrated database retrieval system