Bartonella sp. JB15: BJB15x_003980 Help Entry BJB15x_003980     CDS       T05113                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bart  Bartonella sp. JB15 Pathway bart01100   Metabolic pathways bart01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bart00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJB15x_003980    00074 Mycolic acid biosynthesis     BJB15x_003980   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJB15x_003980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AQX27810 LinkDB All DBs Position 439771..440007 Genome browser AA seq 78 aa AA seqDB search MSDTEERVRKIIVEHLGVDADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIFTVGDAVKFIDKASV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagaagagcgcgttagaaagattatcgtagagcatcttggagttgacgca gataaggtagtagaaaatgcaagctttatcgatgatttaggggcagatagccttgatacg gttgagcttgttatggcttttgaagaagagttcggtatagaaatcccggatgatgctgcc gaaacaattttcacagttggtgatgcagtgaagtttattgataaggcttctgtataa

DBGET integrated database retrieval system