Bacillus sp. SB49: M662_09030 Help Entry M662_09030        CDS       T10339                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism basb  Bacillus sp. SB49 Pathway basb01100   Metabolic pathways basb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:basb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M662_09030 (acpP)    00074 Mycolic acid biosynthesis     M662_09030 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M662_09030 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc DUF7080 Motif Other DBs NCBI-ProteinID:  QHT46625 UniProt:  A0A7Z2SWD0 LinkDB All DBs Position 1717439..1717672 Genome browser AA seq 77 aa AA seqDB search MADTFDRVKQIIVDRLDVDESKVVMEASFKEDLEADSLDVVELVMELEDEFDLEISDEEA EKINTVGDAVNYISSQS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatacatttgatcgcgtaaaacagatcatcgtcgatcgtctcgacgttgatgag tccaaagtggttatggaagcttccttcaaagaagatctagaagcagactctcttgacgta gttgagctagtaatggagcttgaggacgagtttgatttggaaatttctgatgaagaagct gaaaaaatcaatacagtaggcgacgctgtgaattacataagcagccagtcgtaa

DBGET integrated database retrieval system