Bartonella australis: BAnh1_11960 Help Entry BAnh1_11960       CDS       T02469                                  Symbol korB Name (GenBank) KorB protein   KO K03746   DNA-binding protein H-NS Organism baus  Bartonella australis Brite KEGG Orthology (KO) [BR:baus00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:baus03036]     BAnh1_11960 (korB)    03400 DNA repair and recombination proteins [BR:baus03400]     BAnh1_11960 (korB) Chromosome and associated proteins [BR:baus03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BAnh1_11960 (korB) DNA repair and recombination proteins [BR:baus03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BAnh1_11960 (korB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  AGF75063 UniProt:  M1NUW8 LinkDB All DBs Position complement(1490920..1491207) Genome browser AA seq 95 aa AA seqDB search MNDFRGMKPDELREIRAQIDVELKKWQAKEKQDARRKILEIANTHGIDIADLVKKERHYR NPDNQWELWNGRGRKPKWVKEWLKNGCSLEELEVT NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaatgattttcggggtatgaaacctgatgaactacgggaaatacgcgctcaaatcgac gtggaactaaaaaaatggcaggcaaaggaaaagcaggatgcacggcggaaaatccttgaa attgccaatacccacggaattgatattgcagatcttgttaaaaaagagcgccattataga aatccggataatcagtgggagttatggaatgggcgtggacgtaagccaaaatgggttaaa gaatggttaaaaaacggctgctcgctcgaagaactagaagtaacataa

DBGET integrated database retrieval system