Bordetella avium: BAV3109 Help Entry BAV3109           CDS       T00695                                  Name (GenBank) putative exported protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bav  Bordetella avium Pathway bav00190   Oxidative phosphorylation bav01100   Metabolic pathways bav02020   Two-component system Module bav_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bav00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BAV3109  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BAV3109 Enzymes [BR:bav01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BAV3109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  CAJ50719 UniProt:  Q2KUE1 LinkDB All DBs Position complement(3384390..3384515) Genome browser AA seq 41 aa AA seqDB search MWYFSWILGLGLACTFAILNAMWFELREGQAHDPLKQPVSK NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttctcgtggatactcggcctggggctggcttgcaccttcgccattcttaac gccatgtggtttgagctgcgcgaagggcaggcccacgacccgctcaagcagccggtcagc aagtga

DBGET integrated database retrieval system