KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_00300
Entry
CWU_00300         CDS       T01826                                 
Name
(GenBank) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00270  Cysteine and methionine metabolism
baw00543  Exopolysaccharide biosynthesis
baw00920  Sulfur metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01200  Carbon metabolism
baw01230  Biosynthesis of amino acids
Module
baw_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:baw00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CWU_00300
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CWU_00300
  09107 Glycan biosynthesis and metabolism
   00543 Exopolysaccharide biosynthesis
    CWU_00300
Enzymes [BR:baw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     CWU_00300
SSDB
Motif
Pfam: SATase_N Hexapep Hexapep_2
Other DBs
NCBI-ProteinID: ADP67613
LinkDB
Position
58023..58847
AA seq 274 aa
MCILKISRIWNKILYDVSFLLKKEPILSDFYQSSILQHQSFTSSLSYILSNKLSTSMISE
KKIQGIFDDVYLNDRSILNFIVQDIKAVLKRDPAVNDYLTPLLYLKGFHALEAYRISHYL
WNTGKKSLSLYLQSRISSEFSVDIHPAAFIGSGVMLDHATGIVIGEGVTIENDVSILHSV
TLGGTGKNFSQNRHPTIRKGVVIGAGAKILGNIEVGSGAKIGAGSIVLKNVPSDVTVVGV
PAKIVSQVSSKKYYSQKKKNSLKYINIFQHGDGI
NT seq 825 nt   +upstreamnt  +downstreamnt
atgtgtattttgaaaatatcaagaatatggaataaaatactctacgatgtttctttttta
ttaaaaaaagaaccaattttatcagatttttaccaaagtagtattttacaacaccaaagt
tttacaagttctttaagttatatattatcaaataaattatctacatctatgatttctgaa
aagaaaatacaaggtatatttgatgatgtatatctaaatgatcgttctattttaaatttt
atagtgcaagatattaaggctgtactaaaacgagatccagcagtaaatgattatttaaca
cctttactttatttaaaaggtttccatgcattagaagcttatagaataagtcattatctc
tggaatacagggaaaaaatcattatctctgtatctgcaaagtagaatctcttctgaattt
tctgtagatattcatccagcagcgtttattgggtctggtgtaatgcttgatcatgcaact
ggcattgtaatcggagaaggtgtgactatagaaaatgatgtatcaattcttcattcggtt
actttaggaggaactggtaaaaactttagccaaaatagacatcctactattagaaaaggc
gttgttataggggcgggtgccaaaattttaggaaatattgaagtaggttcaggcgcgaaa
ataggtgcgggatcaatagttttaaaaaatgttccttcagatgtaacagttgtaggagta
ccagcgaaaattgttagtcaagtatctagtaaaaagtattattctcagaagaaaaaaaat
agtttaaaatatataaatatatttcaacacggagatggtatttaa

DBGET integrated database retrieval system