Bacillus anthracis H9401: H9401_1881 Help Entry H9401_1881        CDS       T02028                                  Name (GenBank) Acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bax  Bacillus anthracis H9401 Brite KEGG Orthology (KO) [BR:bax00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01053 Biosynthesis of siderophore group nonribosomal peptides     H9401_1881  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bax01008]     H9401_1881 Polyketide biosynthesis proteins [BR:bax01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     H9401_1881 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AFH83267 LinkDB All DBs Position 1860077..1860352 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system