Bacillus anthracis H9401: H9401_1881 Help Entry H9401_1881        CDS       T02028                                  Name (GenBank) Acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bax  Bacillus anthracis H9401 Pathway bax00975   Biosynthesis of various siderophores bax01100   Metabolic pathways bax01110   Biosynthesis of secondary metabolites Module bax_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bax00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     H9401_1881  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bax01008]     H9401_1881 Polyketide biosynthesis proteins [BR:bax01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     H9401_1881 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  AFH83267 LinkDB All DBs Position 1860077..1860352 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system