Bacillus velezensis FZB42: RBAM_005880 Help Entry RBAM_005880       CDS       T00582                                  Name (GenBank) hypothetical protein   KO K06440   similar to spore coat protein Organism bay  Bacillus velezensis FZB42 Brite KEGG Orthology (KO) [BR:bay00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     RBAM_005880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  ABS72980 UniProt:  A7Z1V4 LinkDB All DBs Position complement(565088..565285) Genome browser AA seq 65 aa AA seqDB search MARALHELLEIQEMASFKSLCLTKSKTMKALVSDPQLKEIMQQDVDTSTRQLQEFASILS DAQHE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccttacatgaattactcgaaattcaggagatggcttcttttaagtcactt tgtctgacgaaatctaaaaccatgaaagcgctcgtatccgatccgcagctgaaagaaatc atgcagcaggatgtggatacatcaacaaggcaattgcaggaatttgcctcaattttatct gatgcacagcatgaatga

DBGET integrated database retrieval system