Bacillus velezensis FZB42: RBAM_017140 Help Entry RBAM_017140       CDS       T00582                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bay  Bacillus velezensis FZB42 Pathway bay02024   Quorum sensing bay03018   RNA degradation Brite KEGG Orthology (KO) [BR:bay00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RBAM_017140 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RBAM_017140 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bay03019]     RBAM_017140 (hfq)    03036 Chromosome and associated proteins [BR:bay03036]     RBAM_017140 (hfq) Messenger RNA biogenesis [BR:bay03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RBAM_017140 (hfq) Chromosome and associated proteins [BR:bay03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RBAM_017140 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  ABS74077 UniProt:  A7Z501 LinkDB All DBs Position 1780868..1781089 Genome browser AA seq 73 aa AA seqDB search MKPINIQDQFLNQIRKDNTFVTVFLLNGFQLRGQVKGFDNFTVLLETEGKQQLIYKHAIS TFAPQKNVQLELE NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaaaccgattaatattcaagatcagtttttgaatcaaatccgaaaagacaatacgttc gtcacggtgtttttactcaacggcttccagcttcgcggccaggtaaaaggctttgacaac tttaccgttttgctcgaaacggaggggaagcagcagcttatttataaacatgccatctcc acgttcgccccgcaaaaaaacgtccagcttgagcttgaatag

DBGET integrated database retrieval system