Bacillus velezensis FZB42: RBAM_022060 Help Entry RBAM_022060       CDS       T00582                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bay  Bacillus velezensis FZB42 Pathway bay00998   Biosynthesis of various antibiotics bay01100   Metabolic pathways bay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBAM_022060    00074 Mycolic acid biosynthesis     RBAM_022060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBAM_022060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1280 Motif Other DBs NCBI-ProteinID:  ABS74567 UniProt:  A7Z6E1 LinkDB All DBs Position complement(2342694..2342966) Genome browser AA seq 90 aa AA seqDB search MEQTKEMKQIIAQIIQDIQEQQSYRAVEAGDDVRVIEDLGFSSLDIAQLVAQMEMETGVD PFSQGETISSITTVGSICDIYQKYMDSAQS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaacaaaccaaggaaatgaagcagatcatcgctcaaatcattcaggatattcaagaa cagcagtcatatcgggccgtcgaagcgggggatgatgtgagagtcatagaggatctgggc ttctcatcattggatatcgctcaattagtcgcacagatggagatggaaaccggagtagat cctttttcccaaggagaaacaatttccagcattacaaccgtcggcagcatttgtgatatt tatcaaaaatatatggacagtgctcaatcatga

DBGET integrated database retrieval system