KEGG   Bdellovibrio bacteriovorus HD100: Bd0037
Entry
Bd0037            CDS       T00159                                 
Name
(GenBank) putative oxidoreductase
  KO
K04708  3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
bba  Bdellovibrio bacteriovorus HD100
Pathway
bba01100  Metabolic pathways
bba04382  Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:bba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    Bd0037
 09150 Organismal Systems
  09158 Development and regeneration
   04382 Cornified envelope formation
    Bd0037
Enzymes [BR:bba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     Bd0037
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP Eno-Rase_NADH_b Yos9_DD
Other DBs
NCBI-ProteinID: CAE77719
UniProt: Q6MRN8
LinkDB
Position
complement(32617..33543)
AA seq 308 aa
MGPLFYFFRRKHKQEFKPVVLVTGCSAGIGLAVAHLLRRHPEYRLVLTAREKSLDKLRDE
FLEDERLLIRPLDVTSEADRIQLVNEVSKVWGGIDILINNAGISYRAVVEHMTEKDEELQ
MATNYFGPMGLIRLCLPHMRETGRGKIINVSSVSGMLAMPTMSSYSASKFALEGASEALW
YEMRPFGVTISLVQPGFIHSPSHKNVYHTQNSDPARNWSGPYCDFYKNMTPFVEKMMNMS
LTTPEKVAKQILHTMKTENPPLWIPATLDATVFYYIRRLLPRRVLLPFLYWCLPGARHWA
KEHTHRRS
NT seq 927 nt   +upstreamnt  +downstreamnt
atggggccccttttttatttcttccgtcgcaagcacaagcaagaattcaaacctgtcgtt
ctggtcacgggatgttccgccggtatcggcctggccgttgcgcatcttttgcgccggcat
cctgaatatcgcctggtgctgaccgcgcgggaaaaaagtctggataaacttcgcgacgaa
tttctggaagacgaacgcctgctgattcgtccgctggatgtgacctcggaagccgaccgt
attcagctggtgaacgaagtcagcaaagtctggggtggcatcgacatactgatcaacaac
gccggcatttcttaccgcgcggtggttgaacacatgaccgaaaaagatgaagagctgcaa
atggccaccaactatttcgggcccatgggtttgattcgtctgtgccttccgcacatgcgc
gaaacgggcaggggaaagatcatcaacgtgtcttcggtcagcgggatgctggcgatgccg
acgatgtcttcgtattcggcttcgaaattcgcactggaaggcgcttccgaggccttatgg
tacgaaatgcgcccgtttggtgtgacgatctcgctggtgcaacccggctttattcacagt
ccttcccacaaaaacgtctatcacacccagaactcggatccagcgcgcaactggagtgga
ccgtattgcgatttttataagaacatgactccgtttgtggaaaagatgatgaacatgtcg
ctgaccactccggaaaaagtcgccaaacagatcctgcacacgatgaaaaccgaaaacccg
ccactctggattccagccaccctggatgcgacggtgttctattacatccgtcgtttgctg
cctcgccgggtgcttttgccgttcctgtactggtgcctgccaggggcgcggcattgggcc
aaagagcacacccacagacgatcctaa

DBGET integrated database retrieval system