Bdellovibrio bacteriovorus HD100: Bd0097 Help Entry Bd0097            CDS       T00159                                  Symbol groES Name (GenBank) chaperonin groES   KO K04078   chaperonin GroES Organism bba  Bdellovibrio bacteriovorus HD100 Brite KEGG Orthology (KO) [BR:bba00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bba03110]     Bd0097 (groES)    03029 Mitochondrial biogenesis [BR:bba03029]     Bd0097 (groES) Chaperones and folding catalysts [BR:bba03110]  Heat shock proteins   HSP10    Bd0097 (groES) Mitochondrial biogenesis [BR:bba03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     Bd0097 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  CAE77776 UniProt:  Q6MRI2 LinkDB All DBs Position 90797..91099 Genome browser AA seq 100 aa AA seqDB search MAKNEIGVRPLHDRILVRRMAEEEKTAGGLFIPDTAKEKPQKGEIIATGKGRVTEDGKIL PLEVKVGDKVLFGKYAGTELKLDGAEYLMMREEDILGVFN NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaagaacgaaattggcgttcgcccacttcatgacagaattctagttcgcagaatg gcggaagaagaaaaaaccgctggcggtcttttcattcctgacactgcaaaagaaaaacca caaaaaggcgaaatcatcgcgactggcaaaggccgcgtaactgaagatggcaagatcctt ccattggaagttaaagttggcgataaagttcttttcggcaaatacgctggaactgaattg aaactggatggcgctgaatacctgatgatgcgcgaagaagacatcctgggcgtatttaac taa

DBGET integrated database retrieval system