Bdellovibrio bacteriovorus HD100: Bd3401
Help
Entry
Bd3401 CDS
T00159
Symbol
fliI
Name
(GenBank) flagellum-specific ATP synthase
KO
K02412
flagellum-specific ATP synthase [EC:
7.4.2.8
]
Organism
bba
Bdellovibrio bacteriovorus HD100
Pathway
bba02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
bba00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
Bd3401 (fliI)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
bba02044
]
Bd3401 (fliI)
02035 Bacterial motility proteins [BR:
bba02035
]
Bd3401 (fliI)
Enzymes [BR:
bba01000
]
7. Translocases
7.4 Catalysing the translocation of amino acids and peptides
7.4.2 Linked to the hydrolysis of a nucleoside triphosphate
7.4.2.8 protein-secreting ATPase
Bd3401 (fliI)
Secretion system [BR:
bba02044
]
Type III secretion system
Flagellar export apparatus
Bd3401 (fliI)
Bacterial motility proteins [BR:
bba02035
]
Flagellar system
Flagellar assembly proteins
Type-III secretion
Bd3401 (fliI)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_ab
T3SS_ATPase_C
ABC_tran
RsgA_GTPase
ATP-synt_ab_N
AAA_22
ATP-synt_VA_C
Motif
Other DBs
NCBI-ProteinID:
CAE78199
UniProt:
Q6MHY3
LinkDB
All DBs
Position
complement(3312154..3313482)
Genome browser
AA seq
442 aa
AA seq
DB search
MSEFELNLDKYSDVIQSVHLTKDSGKVTEVNGMLIKGYLPGASVGSIVSINPSGMEKSFL
AEVVGFKDKHVLMMALNDMRGVALGSKIVLARQIATVRAGEELLGRVVDGLGRPLDDKGE
VENFREVPLYSEVRNPLDRRPIREPIDLGIRAINGALTAGLGQRVAIMAGSGVGKSVLLG
MMARNTNADVNVIAMIGERGREVREFIEHDLGPEGMKRSVVVCVTSDQSPLLRMRGAYVA
TALAEYFSSQGKNVLLMMDSVTRFAMAQREIGLSTGEPPSQKGYTPSVFATLPKLLERAG
SFEGEGSITGFYTTLVEGDDMNDPIGDSVRSIVDGHIVLSRSLAQKGHFPAIDIMQSASR
VMRAVSSPEHSKLAQKLRETLAVYKDAEDLINIGAYKPGSNPKIDRAVKVIDQVNDFLKQ
RVEDPTNFTQTVRQMQQILINA
NT seq
1329 nt
NT seq
+upstream
nt +downstream
nt
atgagcgaatttgaactgaacctggataagtattctgacgtgatccagtctgtccacttg
acgaaggacagcggcaaagtcacggaagtgaacgggatgcttatcaaaggatatctgccg
ggcgcaagcgttggcagtatcgtgtccatcaatcccagcgggatggaaaaatccttcctg
gccgaagtggtggggttcaaggacaagcatgttctgatgatggctctgaatgacatgaga
ggcgtggccctgggatcaaaaatcgtcctggcccgtcagatcgccaccgtgcgcgcgggt
gaagagcttttgggccgtgtggtggatggcctgggtcgtcctctggatgacaagggcgaa
gtcgaaaatttccgtgaagttcctttgtacagtgaagttcgcaaccctctggatcgccgt
ccgatccgtgagcctattgacctggggattcgtgccatcaatggcgcattaaccgcagga
ctgggccagcgtgtcgctattatggcgggttccggtgtgggtaagtccgtattgctgggt
atgatggcccgtaatacgaatgccgacgtcaacgtgattgccatgatcggtgaacgtgga
cgtgaggtgcgcgaatttatcgagcacgatctgggcccggaagggatgaaaagatcggtt
gttgtctgtgtgaccagtgaccaaagcccgctgctgcgtatgcggggcgcttatgtggcg
acggctctggctgaatacttctcctctcaggggaagaatgtgttgttgatgatggactcc
gtgactcgttttgcgatggctcaaagggaaatcggtctgagtaccggtgaaccaccatcc
caaaagggttacacccccagcgtctttgccaccctgcctaagctgcttgagcgtgccggg
tcctttgagggcgaaggcagcatcaccggcttctatacgacgctggtggaaggggatgac
atgaatgatccgatcggagattcagttcgttccatcgtggacgggcacatcgttctaagc
cgctctttggctcagaagggtcacttcccggcgattgatatcatgcaaagtgccagccgg
gtgatgcgggccgtgtcctcgccagagcactccaagctggcgcaaaagctgcgtgaaacc
ctggcggtctataaagacgccgaggatttgatcaacatcggtgcctacaagccgggatcc
aatcccaagattgaccgggccgtgaaggtgattgatcaggtgaacgacttccttaaacaa
agagtcgaggacccgaccaacttcacacagaccgtgcgccagatgcagcagattcttatt
aacgcctga
DBGET
integrated database retrieval system