Burkholderiales bacterium GJ-E10: E1O_14320 Help Entry E1O_14320         CDS       T03654                                  Name (GenBank) nucleoid protein Hbs   KO K03530   DNA-binding protein HU-beta Organism bbag  Burkholderiales bacterium GJ-E10 Brite KEGG Orthology (KO) [BR:bbag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bbag03032]     E1O_14320    03036 Chromosome and associated proteins [BR:bbag03036]     E1O_14320    03400 DNA repair and recombination proteins [BR:bbag03400]     E1O_14320 DNA replication proteins [BR:bbag03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E1O_14320 Chromosome and associated proteins [BR:bbag03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E1O_14320 DNA repair and recombination proteins [BR:bbag03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E1O_14320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 UBA_HYPK Motif Other DBs NCBI-ProteinID:  BAP88563 UniProt:  A0A0A1H2L2 LinkDB All DBs Position complement(1561166..1561438) Genome browser AA seq 90 aa AA seqDB search MNKTELIEHIARQADISKAAAGRALDALLGGIRTSLKKGNAVTLVGFGTFAVTKRAARTG RNPRTNEPIKIKAAKVPKFRAGKALKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt ttgaacaagaccgaactgattgaacacatcgcccggcaggcggacatttccaaggctgcg gccggccgtgcgctggacgcgctgctcggcgggattcgtacctcgctgaaaaagggcaac gccgtgaccctggtcgggtttggcacgtttgccgtcaccaagcgtgcggcgcgcaccggc cgcaatccgcgtaccaatgagccgatcaagatcaaggcggcgaaggtcccgaagttccgc gctggcaaagcgctgaaagatgcgctaaactag

DBGET integrated database retrieval system