Burkholderiales bacterium GJ-E10: E1O_17820 Help Entry E1O_17820         CDS       T03654                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bbag  Burkholderiales bacterium GJ-E10 Pathway bbag01100   Metabolic pathways bbag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E1O_17820    00074 Mycolic acid biosynthesis     E1O_17820   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E1O_17820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  BAP88913 UniProt:  A0A0A1H3J5 LinkDB All DBs Position complement(1908902..1909144) Genome browser AA seq 80 aa AA seqDB search MDSIEQRVKKIVAEQLGVNEADIKNESAFVDDLGADSLDTVELVMALEDEFECEIPDEEA EKIRTVQQAIDYVNAHLKKA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggacagcattgaacagcgcgtaaaaaaaatcgtggccgagcaactcggcgtgaacgag gccgacatcaagaacgaatcggcgttcgtggatgacctcggggcggattcgctcgacacc gtggaactggtgatggcgctcgaggacgagttcgagtgcgagattccggacgaagaggcg gagaagatccgcacggtgcagcaggcgatcgactacgtcaacgcccatctgaagaaagcg tga

DBGET integrated database retrieval system