Beijerinckiaceae bacterium MG08: CU048_10375 Help Entry CU048_10375       CDS       T10676                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bbai  Beijerinckiaceae bacterium MG08 Pathway bbai01100   Metabolic pathways bbai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CU048_10375    00074 Mycolic acid biosynthesis     CU048_10375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CU048_10375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QBR71615 LinkDB All DBs Position complement(2219202..2219441) Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVIEHLGVDADKVVDNANFMEDLGADSLDTVELVMAFEEEFSVEIPDDAA ETIVTVGDAIKFLEKASAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgtaaaaaagattgtaattgagcacctcggtgtcgatgcc gacaaagtggtcgacaacgcaaatttcatggaagaccttggcgccgattctctcgatacg gtcgaactcgtcatggctttcgaagaggaattcagcgtcgagattccagacgatgccgcg gaaacgatcgtgaccgtgggcgacgccataaagttccttgaaaaggcgtccgccgcttga

DBGET integrated database retrieval system