Bradyrhizobium barranii subsp. barranii: J4G43_023210 Help Entry J4G43_023210      CDS       T08665                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bban  Bradyrhizobium barranii subsp. barranii Pathway bban01100   Metabolic pathways bban01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bban00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J4G43_023210    00074 Mycolic acid biosynthesis     J4G43_023210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J4G43_023210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UEM16875 UniProt:  A0A7Z0TW25 LinkDB All DBs Position 4871867..4872106 Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgctgcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgacgccgcg gagacgattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system