KEGG   Branchiostoma belcheri (Belcher's lancelet): 109471836
Entry
109471836         CDS       T07532                                 
Name
(RefSeq) ADP-ribosylation factor-related protein 1-like
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
bbel  Branchiostoma belcheri (Belcher's lancelet)
Brite
KEGG Orthology (KO) [BR:bbel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbel04131]
    109471836
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:bbel04031]
    109471836
Membrane trafficking [BR:bbel04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    109471836
GTP-binding proteins [BR:bbel04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    109471836
SSDB
Motif
Pfam: Arf Ras Roc G-alpha SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU
Other DBs
NCBI-GeneID: 109471836
NCBI-ProteinID: XP_019626776
UniProt: A0A6P4ZAR8
LinkDB
Position
Unknown
AA seq 201 aa
MFTLLHGLWKYLFQRDEYCILILGLDNAGKTTFLEQTKIQFTRNYKGMNLNKITSTVGLN
VGKIDVGSVRLMFWDLGGQEELQSLWDKYYAESHGVIYMIDSDDRERLPESKLAFDKMLG
SESLEGVPLLVVGNKQDIENCMTVADIKDVFNESAPRIGKRDCLVQPVSALQGTGINESI
EWMVQCVKRNIHRPPKRSDIT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgttcacgttgttgcacggtctgtggaagtacctgttccagagagatgaatactgtatc
ctcatcttggggcttgataatgcaggcaagacgacatttctggagcaaaccaagatccag
ttcacacgaaactacaaaggaatgaacttgaacaaaatcacaagcacagtgggactcaat
gttggaaagattgatgtgggttcggtccggctgatgttctgggatctgggtgggcaggag
gagttgcagtccctatgggataagtactatgcagagtcacatggtgtcatttacatgata
gactctgatgacagggaaaggttaccagagtccaaacttgcctttgacaagatgcttggc
agtgaatcattggaaggtgtcccactccttgtagtgggcaacaaacaagatattgagaat
tgtatgacagttgcagatataaaagatgttttcaatgagagtgcacctcggataggcaaa
cgggactgcttggtgcaaccagtgtcagctttgcaagggactgggatcaatgagagcatt
gaatggatggttcagtgtgtcaagaggaacatccacagaccacccaaacggagtgacatc
acctga

DBGET integrated database retrieval system