Besnoitia besnoiti: BESB_004070 Help Entry BESB_004070       CDS       T10139                                  Name (RefSeq) dynein light chain DLC   KO K10418   dynein light chain LC8-type Organism bbes  Besnoitia besnoiti Pathway bbes04145   Phagocytosis bbes04517   IgSF CAM signaling bbes04814   Motor proteins Brite KEGG Orthology (KO) [BR:bbes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     BESB_004070  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     BESB_004070   09142 Cell motility    04814 Motor proteins     BESB_004070  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbes03037]     BESB_004070    04812 Cytoskeleton proteins [BR:bbes04812]     BESB_004070 Cilium and associated proteins [BR:bbes03037]  Motile cilia and associated proteins   Dynein arm    BESB_004070 Cytoskeleton proteins [BR:bbes04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      BESB_004070 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light HNOB GH172_dom Motif Other DBs NCBI-GeneID:  40305470 NCBI-ProteinID:  XP_029222075 UniProt:  A0A2A9MP36 LinkDB All DBs Position I Genome browser AA seq 80 aa AA seqDB search MPQASRMSFWLGAALRFQAVEMFKNVRDIADHIKQFFDSKHQPTWNCIVGRYFGSKVTYE SKRYIYFSVGQLSVLLWRCA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccccaggcgtctcgaatgtctttctggcttggggcggcgcttcgttttcaggctgtg gagatgttcaagaacgtccgggacatcgcagaccacatcaagcagttcttcgattcgaag caccagccaacatggaactgcattgtcgggcggtacttcggatcgaaagtcacatacgaa agcaagcgctacatctatttcagcgttgggcagctttccgtccttttgtggcgatgcgcg taa

DBGET integrated database retrieval system