Besnoitia besnoiti: BESB_028040 Help Entry BESB_028040       CDS       T10139                                  Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism bbes  Besnoitia besnoiti Pathway bbes04145   Phagocytosis bbes04517   IgSF CAM signaling bbes04814   Motor proteins Brite KEGG Orthology (KO) [BR:bbes00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     BESB_028040  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     BESB_028040   09142 Cell motility    04814 Motor proteins     BESB_028040  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbes03037]     BESB_028040    04812 Cytoskeleton proteins [BR:bbes04812]     BESB_028040 Cilium and associated proteins [BR:bbes03037]  Motile cilia and associated proteins   Dynein arm    BESB_028040 Cytoskeleton proteins [BR:bbes04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      BESB_028040 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SNU71_N Phi-29_GP4 DUF4070 Motif Other DBs NCBI-GeneID:  40307856 NCBI-ProteinID:  XP_029215378 UniProt:  A0A2A9M097 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MADAASLREYQIPDIVMKGADMCAERVAFAAEVAKKGYVSLLKNDLKYWQEVAQMLKQDF DKKFDGTWHVVVGQHFGAFVTHEAQQMIYFSIGAVNFLIYKHG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggcagacgcggcttctctgcgggagtatcagattcccgacattgtgatgaagggcgcg gacatgtgcgcggagagagtcgcctttgccgcggaagtcgcaaagaagggctacgtgtcg ctgttgaaaaacgatctaaaatactggcaggaagttgcgcagatgctgaaacaagatttc gacaaaaagttcgacggaacgtggcacgtcgtcgttgggcagcactttggggccttcgtg actcacgaggcgcagcaaatgatctacttctccatcggcgccgtcaactttctcatttac aaacacggatga

DBGET integrated database retrieval system