Besnoitia besnoiti: BESB_036480 Help Entry BESB_036480       CDS       T10139                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism bbes  Besnoitia besnoiti Pathway bbes03050   Proteasome bbes03440   Homologous recombination Brite KEGG Orthology (KO) [BR:bbes00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     BESB_036480   09124 Replication and repair    03440 Homologous recombination     BESB_036480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bbes03019]     BESB_036480    04131 Membrane trafficking [BR:bbes04131]     BESB_036480    03051 Proteasome [BR:bbes03051]     BESB_036480    03400 DNA repair and recombination proteins [BR:bbes03400]     BESB_036480 Messenger RNA biogenesis [BR:bbes03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      BESB_036480 Membrane trafficking [BR:bbes04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     BESB_036480 Proteasome [BR:bbes03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      BESB_036480 DNA repair and recombination proteins [BR:bbes03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      BESB_036480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DSS1_SEM1 DUF4404 Motif Other DBs NCBI-GeneID:  40308629 NCBI-ProteinID:  XP_029221199 UniProt:  A0A2A9MND3 LinkDB All DBs Position II:complement(2091777..2093340) Genome browser AA seq 107 aa AA seqDB search MADSTSRAGQEEMKHASGQQAPLHPSSHAGDEHDTFDEPDDELEEFDEIGGDDGVVDTEV AQWDEDWDAAGWDDEDVNDDFCKRLQQELEAFKQAHPNAAKAQARPA NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcggacagcaccagcagagccgggcaggaggagatgaagcacgcctctggacaacag gcgcctcttcatccttccagccacgcgggagacgagcacgacacgttcgatgaacctgat gacgaactggaagaattcgacgaaattggaggagatgacggcgttgtggataccgaagtc gcccagtgggatgaggactgggacgcagcgggatgggatgatgaagatgtgaacgacgac ttctgcaagcggctccagcaggaactggaggctttcaagcaggcgcacccgaacgcggcg aaggcgcaagcgagaccagcgtaa

DBGET integrated database retrieval system