Bradyrhizobium betae: F8237_01185 Help Entry F8237_01185       CDS       T06368                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bbet  Bradyrhizobium betae Pathway bbet01100   Metabolic pathways bbet01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbet00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F8237_01185    00074 Mycolic acid biosynthesis     F8237_01185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F8237_01185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QFI71103 UniProt:  A0A4Q1UUG8 LinkDB All DBs Position complement(239670..239909) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgcagcgagcttcatcgacgaccttggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgacgccgcg gagactattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system