KEGG   Bradyrhizobium betae: F8237_14040
Entry
F8237_14040       CDS       T06368                                 
Symbol
trbJ
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
bbet  Bradyrhizobium betae
Pathway
bbet02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbet00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    F8237_14040 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbet02044]
    F8237_14040 (trbJ)
Secretion system [BR:bbet02044]
 Type IV secretion system
  Trb secretion system protein
   F8237_14040 (trbJ)
SSDB
Motif
Pfam: DUF3535 DUF948 Hypoth_Ymh Mod_r ALIX_LYPXL_bnd COG3_N DUF4141 BORCS6 FapA CHASE8 ACC_epsilon
Other DBs
NCBI-ProteinID: QFI73417
UniProt: A0A5P6P4Y3
LinkDB
Position
complement(2942434..2943195)
AA seq 253 aa
MKLRNSRAARFAAALLTAPVALAPMLATPAHAIIVFDPSNYAQNVLTAARSLQQITNQIT
SLQNEAQMLINQARNLASLPFSSLQQLQQSVQRTQQLLNQAQNIAYDVQQIDRMFQQKYG
NVSLSASDQQLVTDARSRWQNTVGGLQDAMRVQAGVVGNIDTNRTQMSALIGQSQGATGA
LQATQAGNQLLALQAQQLADLTAVVAANGRAQALQSAEQAAAAEQGREQRRRFLTPGSGY
QPGNARMFPNSGN
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaaactgcgcaattcccgcgcagcgcgttttgctgccgcgctgctgaccgctcccgtc
gcgctcgcgcccatgctggcgacgcccgctcacgccatcatcgtattcgatccctcgaac
tatgcgcagaacgtgctcacggcggcgcgatcgcttcagcagatcaccaaccagatcacc
tcgcttcagaacgaagcgcaaatgctgatcaaccaggcacgcaaccttgcgagcctgccg
ttctcgtcgctgcaacagcttcagcagtccgtccagcgcacgcagcagcttctcaaccag
gcgcagaatatcgcctacgacgtccagcagatcgaccggatgttccagcagaagtacggg
aacgtctcgctgtccgcttcggatcagcaactcgtcaccgatgcccgctcgcgctggcag
aacacggtcggcggcctgcaggacgcaatgcgggtgcaggcgggcgtcgtcggcaacatc
gacaccaatcgcacgcagatgtcggcgctgatcggccagagccagggcgcgaccggcgcg
ctgcaggcgacgcaggccggcaaccaactccttgcgctccaggcgcagcaactcgcggat
ctcaccgccgtcgtggcggccaacggccgggcgcaggccttgcagtcggccgagcaggcc
gccgccgccgaacagggccgcgagcagcgccggcgtttcctgacgccgggctcgggctac
cagcccggcaatgcccgcatgttcccgaacagcggcaactga

DBGET integrated database retrieval system