KEGG   Bradyrhizobium betae: F8237_23975
Entry
F8237_23975       CDS       T06368                                 
Name
(GenBank) AAA family ATPase
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
bbet  Bradyrhizobium betae
Pathway
bbet03420  Nucleotide excision repair
bbet03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bbet00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    F8237_23975
   03430 Mismatch repair
    F8237_23975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbet03400]
    F8237_23975
Enzymes [BR:bbet01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     F8237_23975
DNA repair and recombination proteins [BR:bbet03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     F8237_23975
   MMR (mismatch excision repair)
    Other MMR factors
     F8237_23975
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 PcrA_UvrD_tudor AAA_11 Metallophos_C
Other DBs
NCBI-ProteinID: QFI75197
UniProt: A0A5P6PA00
LinkDB
Position
complement(5000099..5002720)
AA seq 873 aa
MIRMTEPSKITSESVPDHQPAAGGIAARARASVGPKYLAGLNPEQRDAVETLDGPVLVLA
GAGTGKTRVLTTRIAHILSQGRARPAEILSVTFTNKAAREMKHRLGQMLGHAVEGMPWLG
TFHSIGGRILRTHAELAQLKSNFTVLDTDDQVRLLKQLLQADNIDDKRWPARMLAGLIDG
WKNRGLTPSQVPPGEAAVFANGKGGKLYASYQERLKILNAADFGDLLLEDIRIFREHPDI
LRQYQQRFKYILVDEYQDTNVAQYLWLRLLSQAPSSCASPRMRGEAASQSDANEGDSPST
ALVETPPHPDLLSASEARRDPASGEKEKTPHIKNICCVGDDDQSIYGWRGAEVDNILRFD
HDFPGAKVIRLERNYRSTGHILAAASHLIAHNEGRLGKTLRTEDQDGEKVTVTGSWDSEE
EARGIGEEIEQIQRKGEKLNEIAILVRASYQMREFEDRFVTLGLPYRVIGGPRFYERAEI
RDALAYLRVINSPADDLAFERIVNTPKRGLGDATVQMLHDHARKRRIPLFEAARAVVETD
ELKPKARGSLRDVVASFDRWRAQREVTAHTDLAQIVLDESGYTEMWQKDRSADAAGRLEN
LKELVRSMEEFENLQGFLEHISLVMDRDSGADEDAVSLMTLHSAKGLEFDNVFLPGWEEG
LFPSQRTLDEQGRAGLEEERRLGHVGITRARRRAMIYFATNRRIHGTWSTTIPSRFLDEL
PAANVEITESKGGSAWGGTGGYGASRFDDMEAFGSTYSTPGWQRAQANRNRGGGRNGGGG
SGGFEEQTSSFSSASSPGPDFGSFSSRRRGPMTIEGELVAKSTGTTSEFSLADRVFHQKF
GYGRVTRIDGNKLTIAFDKAGEKKVVDSFVQRA
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgattcgcatgaccgagccaagcaagatcacctccgagagcgtccccgaccaccagcct
gcggccggcggcatcgccgcgcgtgcgcgcgcctcggtgggcccgaaatatctggcgggg
ctcaatccggagcagcgcgacgccgtggagacgctggacggcccggtcctggtgctggcc
ggtgccggcaccggcaagacccgcgtgctgaccacgcgcatcgcccacatcctgagccag
ggccgcgcccgccccgccgagatcctgtcggtgaccttcaccaacaaggccgcgcgcgag
atgaagcaccggctcggccagatgctcggccacgccgtcgaaggcatgccgtggctcggc
actttccattccatcggcggccgcatcctgcgcacccatgccgagctggcgcagctcaag
tcgaacttcaccgtgctcgacaccgacgaccaggtgcggctgctgaagcagctcctgcag
gccgacaacatcgacgacaagcgctggcccgcgcgcatgctggccggcctgatcgacggc
tggaagaaccgcggcctgacgccgtcgcaggtgcccccaggcgaagccgcggtcttcgcc
aacggcaagggcggcaagctctatgcgagctaccaggagcgcctgaagatcttgaacgcc
gccgatttcggcgacctgctgctcgaagacatccgcatcttccgcgagcacccggatatc
ctcaggcagtaccagcagcgcttcaaatacatcctggtcgacgagtatcaggacacgaac
gtcgcgcaatatctgtggctgcggctgctgtcgcaggcgccgtcttcttgcgcctctccc
cgcatgcggggagaggccgcatcgcaaagcgatgcgaatgagggggactctcccagcacc
gcgctcgtggagactccccctcatcccgaccttctcagcgcgagcgaagctcgtcgcgat
cccgcaagtggggagaaggagaagacaccccacatcaagaacatctgctgcgtcggcgac
gacgaccagtcgatctatggctggcgcggcgcggaggtcgacaacatcctgcgtttcgac
cacgatttccccggcgccaaggtgatccgcctcgagcgcaactaccgctcgaccggccac
atcctcgccgccgcctcgcatctgatcgcgcacaacgaaggccggctcggcaagacgctg
cgcaccgaggaccaggacggcgagaaggtcacggtcacgggctcctgggattccgaagag
gaagcccgcggcatcggcgaggagatcgagcagatccagcgcaagggcgagaagctgaac
gagatcgccattctcgtgcgcgcctcctaccagatgcgcgagttcgaagaccgtttcgtc
acgctcggcctgccttatcgcgtcatcggcggcccgcgcttctacgagcgcgccgagatc
cgcgacgcgctggcttacttacgcgtcatcaattcgccggccgacgatctcgccttcgag
cgcatcgtcaacacacccaagcgcggccttggcgatgccaccgtgcagatgttgcacgat
cacgcccgcaagcgccgcatcccgctgttcgaggcggcgcgcgcggtggtcgagaccgac
gagttgaagccgaaagcgcgcggcagcttgcgcgatgtcgttgccagtttcgaccgctgg
cgtgcccagcgcgaggtcaccgctcacaccgatctcgcccagatcgtgctcgacgagagc
ggctacaccgagatgtggcagaaggaccgctcggcggacgccgcgggccggctggagaat
ttgaaagaactcgtgcgctcgatggaggagttcgagaacctgcaagggtttttggagcac
atttcgctggtgatggaccgcgacagcggcgccgacgaggacgcggtgtcgctgatgacg
ctgcactcggccaagggcctcgaattcgacaacgtgttcctgcccggctgggaggaaggc
ctgttcccgagccagcgcacgctggacgaacagggccgcgccggcctcgaggaagaacgc
cgtctcggccatgtcggcatcacccgcgcccgccgccgcgccatgatctatttcgcgacc
aaccggcgcatccacggcacctggtcgaccacgatcccgtcgcgcttcctcgacgaactg
ccggcggccaatgtcgagatcacggagtccaagggcggctcggcctggggcggcaccggc
ggctacggcgcctcgcgcttcgacgacatggaggcgttcggctcgacctattcgaccccg
ggctggcagcgggcacaagccaaccgcaaccggggtggcggccgcaatggcggcggcgga
agcggcggtttcgaggaacagacctcgtcgttctcgtccgcttcatcgcccggccccgat
ttcggcagcttctcctcgcgccggcgcgggccgatgacgatcgagggtgagctggtcgcc
aaatcgaccggcacgacctcggaattctcgcttgccgaccgcgtcttccaccagaagttc
ggctacggccgcgtcaccaggatcgacggcaacaagctcaccatcgccttcgacaaggcc
ggcgagaagaaggtcgtggacagcttcgtgcagcgggcgtga

DBGET integrated database retrieval system