Bombus bifarius (two-form bumblebee): 117204522 Help Entry 117204522         CDS       T07537                                  Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:bbif00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     117204522  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:bbif03016]     117204522    04121 Ubiquitin system [BR:bbif04121]     117204522 Transfer RNA biogenesis [BR:bbif03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     117204522 Ubiquitin system [BR:bbif04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    117204522 SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS FF_URN1 Motif Other DBs NCBI-GeneID:  117204522 NCBI-ProteinID:  XP_033297905 UniProt:  A0A6P8M5K9 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MSIESSSIPVIIEFGGGAELLFDKKKKHSVDLPGNEWTIQKLLFWIKDNLLKERPELFMQ GDTVRPGILVLVNDTDWELLGESNYNINSGDTILFISTLHGG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtctatcgaaagtagcagtattcccgtgatcattgaatttggaggtggggcagaatta cttttcgacaaaaagaaaaagcactctgtggatttacctggaaacgaatggactatacaa aagttacttttctggataaaagataaccttctaaaagaacgaccggaactttttatgcaa ggagacaccgtgcgaccaggaattttggtacttgtaaatgacaccgattgggaattattg ggcgagagcaattacaacataaactcaggcgacacgatattgtttatatccaccttacac ggaggatag

DBGET integrated database retrieval system