Bombus bifarius (two-form bumblebee): 117211993 Help Entry 117211993         CDS       T07537                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif04013   MAPK signaling pathway - fly bbif04145   Phagosome bbif04148   Efferocytosis bbif04310   Wnt signaling pathway bbif04620   Toll-like receptor signaling pathway bbif05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bbif00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     117211993    04310 Wnt signaling pathway     117211993  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     117211993    04148 Efferocytosis     117211993  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117211993  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     117211993  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbif04131]     117211993   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbif04147]     117211993    04031 GTP-binding proteins [BR:bbif04031]     117211993 Membrane trafficking [BR:bbif04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117211993  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     117211993   Macropinocytosis    Ras GTPases     117211993  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     117211993 Exosome [BR:bbif04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117211993   Exosomal proteins of other body fluids (saliva and urine)    117211993   Exosomal proteins of colorectal cancer cells    117211993   Exosomal proteins of bladder cancer cells    117211993 GTP-binding proteins [BR:bbif04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117211993 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  117211993 NCBI-ProteinID:  XP_033312301 UniProt:  A0A6P8MES5 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctatcaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctc ataagctacactaccaatgctttccctggagaatatattccaactgtatttgacaattat tccgcaaatgttatggtggatggtaaaccaataaatcttggtttatgggacacagcaggc caagaagattatgacagattaagaccattgtcttacccacagacagatgtttttctgatc tgcttctctcttgttaaccccgccagttttgaaaatgttcgtgctaaatggtatccagaa gtacgccatcattgtccagctactccaattattttagtagggactaaactagatttacgt gaagacaaagagactattgagcggttaaaagataaaaaacttgcacctattacatatcct cagggtttgtccatggcaaaagagattggtgctgtaaaatatttagaatgttctgctctt actcagaaaggtttgaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt ctccaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system