Bombus bifarius (two-form bumblebee): 117212160 Help Entry 117212160         CDS       T07537                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bbif00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117212160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bbif04121]     117212160    03400 DNA repair and recombination proteins [BR:bbif03400]     117212160 Ubiquitin system [BR:bbif04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117212160    Cul5 complex      117212160 DNA repair and recombination proteins [BR:bbif03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117212160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  117212160 NCBI-ProteinID:  XP_033312566 UniProt:  A0A6P8MFG4 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKIPPVNQQLFNKDNVPMSDSKFLSD YGLTSSTAKPQCPALVGLAVRQENGQFEALEMTPFSLPPDLPDVMKSQEANGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctaatgatccgacgaaaaaatatgaccatatttaccgatgccaaggat aataccacagttcttgaacttaaaaaaattatagaaggtatattgaaaataccacctgtg aatcaacagctgttcaataaggacaatgttccaatgtcagatagtaaatttttatctgat tatggactaacatcatcaactgcaaaaccacaatgtcctgcattagtaggattagctgtg cgtcaagaaaatggtcaatttgaagcattagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaagccaatggacaagaacagtcaccttga

DBGET integrated database retrieval system