Bombus bifarius (two-form bumblebee): 117215154 Help Entry 117215154         CDS       T07537                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif00480   Glutathione metabolism bbif00590   Arachidonic acid metabolism bbif00980   Metabolism of xenobiotics by cytochrome P450 bbif00982   Drug metabolism - cytochrome P450 bbif01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:bbif00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     117215154   09106 Metabolism of other amino acids    00480 Glutathione metabolism     117215154   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     117215154    00982 Drug metabolism - cytochrome P450     117215154 Enzymes [BR:bbif01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      117215154  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      117215154 SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_C_2 GST_C_7 NUDIX Motif Other DBs NCBI-GeneID:  117215154 NCBI-ProteinID:  XP_033317468 UniProt:  A0A6P8N8V9 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MLVADRRKVARSTAICRYLAKQYDLAGKTDWANLHIDATVDTIHDIRHKIAAFHYEEDEK VKAAKRKAAEETLLFILERLDQQVKENDGYFYDGTLSWADLTFVALLDYLNFMYKSDLIE NYENLKLLEKKVLLLPKIKNWIERRPVSEF NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgctcgtagctgatagaaggaaggttgctcggtctacagctatttgccgttacttagcc aaacaatatgacttagctggaaagactgactgggcaaatcttcatattgatgccactgtt gatactattcatgatattcgtcataaaattgccgccttccactatgaggaggacgagaag gtcaaagctgcaaaacgcaaggctgctgaagagacgctgctgttcattttagaacgtttg gaccagcaagtgaaggaaaatgacggctacttctacgatggtactctctcttgggctgat ttaacattcgttgctctgctcgattatttgaactttatgtacaagtctgatctgatcgag aattacgagaatctgaagctgctggagaaaaaggtcctcctccttcccaagatcaaaaac tggattgagagacgcccagttagcgaattttaa

DBGET integrated database retrieval system