Bombus bifarius (two-form bumblebee): 117216084 Help Entry 117216084         CDS       T07537                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism bbif  Bombus bifarius (two-form bumblebee) Pathway bbif00480   Glutathione metabolism bbif00590   Arachidonic acid metabolism bbif00980   Metabolism of xenobiotics by cytochrome P450 bbif00982   Drug metabolism - cytochrome P450 bbif01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:bbif00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     117216084   09106 Metabolism of other amino acids    00480 Glutathione metabolism     117216084   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     117216084    00982 Drug metabolism - cytochrome P450     117216084 Enzymes [BR:bbif01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      117216084  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      117216084 SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_2 GST_N_3 GST_N_2 GST_C_7 CdiI_ImmP Motif Other DBs NCBI-GeneID:  117216084 NCBI-ProteinID:  XP_033318498 UniProt:  A0A6P8NBI7 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search MFLVTPYGLLPMLVADRRKVAQSTAICRYLAKQYDLAGKTDWANLHIDATVDTIHDIRHK IAAFHYEEDEKVKAAKRKAAEETLPFILERLDQQVKENDGYLYDGTLSWADLTFVALLDY LNFMYKSDLIENYENLKLLEKKVLLLPKIKNWIERRPVSEF NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgtttttagtgactccttatggcctgcttcctatgctcgtagctgatagaaggaaggtt gctcagtctacagctatttgccgttacttagccaaacaatatgacttagctggaaagact gactgggcaaatcttcatattgatgccactgttgatactattcatgatattcgtcataaa attgccgccttccactatgaggaggacgagaaggtcaaagctgcaaaacgcaaggctgct gaagagacgctgccgttcattttagaacgtttggaccagcaagtgaaggaaaatgacggc tacttatacgatggtactctctcttgggctgatttaacattcgttgctctgctcgattat ttgaactttatgtacaagtctgatctgatcgagaattacgagaatctgaagctgctggag aaaaaggtcctccttctgcccaagatcaaaaactggattgagagacgcccagttagcgaa ttctaa

DBGET integrated database retrieval system