KEGG   Babesia bigemina: BBBOND_0103960
Entry
BBBOND_0103960    CDS       T08062                                 
Name
(RefSeq) 6-phosphofructokinase, putative
  KO
K24182  6-phosphofructokinase [EC:2.7.1.11]
Organism
bbig  Babesia bigemina
Pathway
bbig00010  Glycolysis / Gluconeogenesis
bbig00030  Pentose phosphate pathway
bbig00051  Fructose and mannose metabolism
bbig01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBBOND_0103960
   00030 Pentose phosphate pathway
    BBBOND_0103960
   00051 Fructose and mannose metabolism
    BBBOND_0103960
Enzymes [BR:bbig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BBBOND_0103960
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 24562627
NCBI-ProteinID: XP_012766272
UniProt: A0A061CZN5
LinkDB
Position
I:complement(900836..905041)
AA seq 1347 aa
MSQERLFGSSVGHSRSRLFSSDAPDVLGLESGCASPKNVASVECMQYTNRDDAVERRRSR
FHITPRATAIRRSANSRGGMQSAPMKQHNTVDFACNVGNELSEGWLPAPWCHAFPGDELK
RINSCYTSKSCCQWQYTNRDIELPKLLQFDFHLLEEHESSGEDLRDFEELSGVLGHIAGN
KMVSVQPQVLCSATSTHPTMKIGMVLSGGPAPGGHNVIAGVFDYLYLRNTQSQLIGFHGG
LDGFLNRQHEIVSYDLMEKFRNMGGFNMLLSGRGKVTGMADLDRAVEAVNDLDLDGLIIV
GGDGSNSNAALLANHFAWRQSADIDDGHPVLRKPCCVVGVPKTVDGDVQSHNIEVSFGFD
TAARTYSELIGNLCTDASSTQYTYHFIRVMGRSASHLALECGMQTHPNVVLIGEEVRRKQ
QSLSSIVDDIVNLMEKRYHMGKPYGVVLIPEGLIEFIPEINVLITELNEIILKSEGPVTH
LAPERLTKSRATWEALPDNIREQLLMDREATGYVMLAKIATERLLLMLVEARIAQRKLEH
LASLTFMTHYFGYEGRCAMPSDFDGAYCYSLGYNAGVLINAQRNGYMSVIRDLKSPISDW
TPLGVPFLHLMQMIDLGGRRVPAIRKTLLNLDGNLFKVFEKVRDTWAYEDLYRSPGPIQL
FDSDSERCFCIADPTVEDLVGKPKSAADSKSRFLLQRHIDCMSPLQRNRLGVRPPIPTLC
SDKRARMKMFKQVLSNDPYTRNQVALNYPYMIRRCHFNLYEVVSQYPEVELNQEDVNVPM
KVGVVVLTKQAPGVLNVIWGLYERLALRGSSCVAFNGARGLVEGDYIELSAGDFDLFRNQ
GGLELVHRSRVHYFHDPENWGLALKTCTSLGLDGLVILGDESAMTQAALLTEYFLSKNSN
ICVVGVPVAGSNGLAGPLIESCVGFDSNAQLYAALVGNVLTDAVSMPKYWHFVKILGRYP
SLEVLECALQTHPNFIIIAEEYGSADKTLFDVVRDIADAVCKRAVMGKNYGTVLIPDHLV
LHLPNTKSMLTELRAVLMEATAAGKRREAVDSFLNYSKGNDNGNEWVHKMTPWSLGVFTS
LPTYIRSELLNFDTEVALERLDIEIMLAKMVKEELNVRKAKGEYRGNYAAVTHYFGYQGR
CCMPSEFDCSLAFAYGHLAAISVESRLTGVCCSIRGLCGTVKDWKLFAVPLTSLMKVEPN
ILTALSLNSYKKGELPIIPSSTVSLKSKAFKKLTMARKKWLFDDLFSNPGPIQFNGSVTP
QSLVLLTEHAEYYQMLRGVERFVHVLQNTCKFGVSEEYLNHAFVQLWGLLRVNQAPGDLV
GLADTIKSDDDLPPTTSVTPSSLNSFI
NT seq 4044 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggctattcggcagctcagtgggccactcaaggtcgcgtctgttttcc
agcgatgctcctgatgtgcttggccttgagagcgggtgcgcgagcccgaaaaatgttgct
tcggtagaatgcatgcaatataccaatagggacgatgccgtggagaggcgccgcagccgc
ttccacatcaccccgagggcgactgcgatccgccgctccgccaacagccggggcggcatg
cagtcggcgccgatgaagcaacacaacacagtggactttgcgtgcaatgtggggaacgag
ctgtcagagggttggttgccagcgccgtggtgtcatgcgtttccaggggatgagctgaag
cgcatcaattcgtgctacacgtccaagagctgctgtcagtggcagtacacgaaccgtgat
atcgagttgccgaaactgttgcaattcgattttcacctgttggaggagcacgagagcagc
ggtgaggatttgcgtgactttgaggagttgtctggtgttctggggcacattgccggtaac
aaaatggtttcggtgcagccccaggtgctatgttccgccacgagtacccaccctaccatg
aaaatcggtatggttctgagtggcggccccgcccccggtggccataacgttatcgccggt
gtcttcgactatttgtacctgcgcaacacgcagtcccaacttatagggttccatggcggt
ctggacggttttctgaatcgccagcacgagatcgtttcttatgacttgatggaaaagttc
cgcaacatgggtggtttcaacatgctgctgtccggtcgcggcaaggtgaccggcatggct
gacctcgaccgtgccgtcgaggccgtcaacgacctggatttggacggtttgattatcgta
ggtggtgacggctcgaacagcaacgccgcgctgctcgccaaccacttcgcgtggcgccag
tctgctgacatcgatgacggtcacccggtgctgcgcaagccctgctgcgtggtcggcgtc
ccgaaaactgtggacggcgacgtgcaatcgcacaacatcgaggtgagcttcgggttcgac
accgctgcgcgcacgtactccgagctcattggcaacctgtgcaccgacgccagcagcact
cagtacacttaccatttcattcgcgtcatgggtcgttccgcgtcccatttggccttggag
tgcggtatgcagacgcacccgaacgtagttctgattggggaggaggtccgccgaaagcag
cagtctctttcctccatcgtcgacgacatcgtgaacctgatggaaaagcgttaccacatg
ggcaagccgtacggcgtggtgctgattcccgagggcctcatcgagttcatccccgagatc
aacgttctgatcaccgagttgaacgagatcatcctaaaatcggagggccctgtcacccac
ctcgcgcctgagaggctgactaagagccgcgccacctgggaagcgctgccggacaacatc
cgcgagcagctgctgatggaccgtgaagccacgggctacgtgatgctggccaagatagcc
actgagcgtctgctgctgatgctggtggaagcgaggatcgcgcagcgtaagctggagcac
ttggcctctttgaccttcatgacccactacttcggctacgaaggccgctgtgccatgccg
tcggacttcgacggcgcgtactgctactccctgggttacaacgccggtgtgctcatcaac
gcccaacgcaacggctacatgtccgtcattagggacctcaagtcccctatatccgattgg
acgccgctgggtgtaccgtttttgcacctcatgcagatgatcgacctgggaggtcgccgc
gtgccggcgattcgcaagaccctgctcaacctcgacggcaaccttttcaaggtattcgaa
aaggtgcgtgacacttgggcgtacgaggatctctatcggtctcccggcccgattcagctc
tttgacagcgacagcgagcggtgcttctgcattgccgaccccactgtggaggacctggtg
ggcaagcccaagtccgccgctgactcaaagtcccgtttcctcctgcagcgccacatcgac
tgcatgagtccgcttcagcgcaaccgcttgggtgtgcggcctccgatcccgacgctgtgc
agcgacaagcgtgcgcgcatgaagatgttcaagcaggttctgagcaacgacccctacacg
cgcaaccaggtggcgctcaactacccgtacatgatccgtcgctgccacttcaacctgtac
gaggttgtgagccagtacccggaggtggagctgaaccaggaggatgtgaacgtccccatg
aaagtcggcgtggttgtcctgaccaagcaggcgcccggcgtgttgaacgtaatatggggt
ctctatgagcgcctggctcttcgcggcagcagctgcgtggccttcaatggcgcgcgcggt
ttggtcgagggtgactacattgagctgtcggctggcgacttcgatctcttccgcaaccaa
ggtggactcgagttggtccaccgttctcgcgtgcactacttccacgaccccgaaaattgg
ggtttggcgctgaagacctgcacgtctctgggcctggatggcctggtgatactgggcgac
gaatctgcgatgacgcaggccgccctgttgaccgagtatttcttgagcaagaatagcaat
atttgcgttgtcggtgtacccgtcgcaggctcaaatggcctggcgggcccgctaattgag
agctgcgttggatttgactccaacgcgcaattgtacgccgctctggtcgggaacgttctg
acagacgccgttagcatgccgaaatattggcattttgtaaagattctgggtcgctacccc
agtttggaagtgctggaatgcgcgctgcaaacccaccccaactttatcatcattgctgag
gagtatggctcagccgacaagaccctgttcgacgttgtgcgtgacattgccgacgccgtg
tgcaagcgtgccgtgatgggaaagaactacggtacggtgctgatccccgatcatttggtt
ttgcacctccccaacaccaaatccatgctcacggagctgcgcgcggtgctgatggaggcc
accgctgctggcaagcgccgcgaggccgttgacagcttcttgaactacagcaagggtaat
gacaatggcaacgagtgggtgcacaagatgaccccgtggagccttggcgtgttcacgtcg
ctgccaacgtacattcgcagcgagttgctgaacttcgacaccgaggtggcgttggagcgc
ctggacattgagattatgttggcgaagatggtgaaggaagagctgaacgtgcgcaaagcg
aagggcgagtaccgcggcaactacgccgctgtcacgcattacttcggttaccaggggcgg
tgctgcatgccgtccgagttcgactgcagccttgcgttcgcctacggtcacctggctgcc
atctccgtggagagccgtttgactggcgtttgctgctctatccgcggcctgtgcggcacg
gtcaaggactggaagctgttcgccgtcccgctgaccagcctgatgaaggtcgagcctaac
attttgacagcgctgtcgctgaactcgtacaagaagggtgagctgcccattattcccagc
tcgacggttagtctgaagagcaaggcgttcaaaaagctcacgatggcccgtaagaagtgg
ctgttcgatgacctgttcagcaaccccggccccatccagttcaacggctccgtgaccccg
cagagcctggttctgctcacggagcacgccgagtactaccagatgctgaggggcgtcgag
cgcttcgttcacgtgttgcagaacacatgcaagtttggcgtgagcgaggagtacctgaac
catgccttcgtgcagctctggggcctgctgagggtcaatcaggcgcccggcgacctggtg
ggcctggccgatacgataaagtccgacgacgacttgcctcctacgacctccgtcacccct
tcttcactaaactcttttatttaa

DBGET integrated database retrieval system