Babesia bigemina: BBBOND_0209790 Help Entry BBBOND_0209790    CDS       T08062                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism bbig  Babesia bigemina Pathway bbig04145   Phagocytosis bbig04517   IgSF CAM signaling bbig04814   Motor proteins Brite KEGG Orthology (KO) [BR:bbig00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     BBBOND_0209790  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     BBBOND_0209790   09142 Cell motility    04814 Motor proteins     BBBOND_0209790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbig03037]     BBBOND_0209790    04812 Cytoskeleton proteins [BR:bbig04812]     BBBOND_0209790 Cilium and associated proteins [BR:bbig03037]  Motile cilia and associated proteins   Dynein arm    BBBOND_0209790 Cytoskeleton proteins [BR:bbig04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      BBBOND_0209790 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Motif Other DBs NCBI-GeneID:  24564367 NCBI-ProteinID:  XP_012768012 UniProt:  A0A061D578 LinkDB All DBs Position II Genome browser AA seq 97 aa AA seqDB search MVDNEIAAGIRPETVVKHVDMDEPTRRFAIDLATEAIEKYKIEKDIAAYIKKEFDKRFEP TWHCVVGRNFGSFVTHEKHCFIYFYVGNMAILLFRNG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggttgacaacgagatcgccgcgggcatccgcccggagaccgtggtgaagcacgtcgac atggacgagcccacgcgcaggttcgccatcgacctggccactgaggccatcgagaagtac aagatcgagaaggacatcgcggcgtacattaagaaggagttcgacaagcgcttcgagccc acgtggcactgcgtggtcggccgtaacttcgggtcgttcgtcacgcatgaaaagcactgc ttcatctacttctacgtcggcaacatggcgatcctgctgttcaggaacgggtag

DBGET integrated database retrieval system