Bison bison bison (American bison): 104981453 Help Entry 104981453         CDS       T08726                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04014   Ras signaling pathway bbis04024   cAMP signaling pathway bbis04072   Phospholipase D signaling pathway bbis04137   Mitophagy - animal bbis04140   Autophagy - animal bbis04218   Cellular senescence bbis04371   Apelin signaling pathway bbis04625   C-type lectin receptor signaling pathway bbis04810   Regulation of actin cytoskeleton bbis05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104981453 (RRAS2)    04014 Ras signaling pathway     104981453 (RRAS2)    04371 Apelin signaling pathway     104981453 (RRAS2)    04072 Phospholipase D signaling pathway     104981453 (RRAS2)    04024 cAMP signaling pathway     104981453 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104981453 (RRAS2)    04137 Mitophagy - animal     104981453 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     104981453 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104981453 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104981453 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     104981453 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104981453 (RRAS2)    04031 GTP-binding proteins [BR:bbis04031]     104981453 (RRAS2) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104981453 (RRAS2)   Exosomal proteins of bladder cancer cells    104981453 (RRAS2) GTP-binding proteins [BR:bbis04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104981453 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  104981453 NCBI-ProteinID:  XP_010828877 UniProt:  A0A6P3GQB8 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MLVLGQVSINFKIMLFFLQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGA MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQV TQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKK GCHCVIF NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgttggtacttgggcaagtaagcataaattttaaaattatgttatttttcttacagtct tattttgtaacggattatgatccaaccatcgaggattcctacacaaagcagtgtgtgata gatgaccgggcagcccggctagacattctggatacagcgggacaagaggaatttggagct atgagagaacagtatatgagaactggcgagggtttccttttggtcttttcagtcacagac agaggcagttttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgt gatgagtttccaatgattttaattggtaataaagcagatctggatcatcagagacaggta acacaggaagaaggacagcagttagcacggcaacttaaggtaacatacatggaggcgtca gcaaagattagaatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaa tttcaagagcaggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaa ggctgccattgtgtcattttctaa

DBGET integrated database retrieval system