Bison bison bison (American bison): 104981845 Help Entry 104981845         CDS       T08726                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104981845  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104981845   09163 Immune disease    05322 Systemic lupus erythematosus     104981845   09165 Substance dependence    05034 Alcoholism     104981845  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104981845 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104981845 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  104981845 NCBI-ProteinID:  XP_010829397 Ensembl:  ENSBBBG00000001434 UniProt:  A0A6P3GRU7 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MLIATATMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYE ETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgctgattgcgacagcaaccatgtctggtcgtgggaagggtggcaaaggcctcggcaag gggggtgctaagcgccatcgcaaagtcttgcgggacaacattcagggtattactaagcca gctatccggcgtctggctcgtcgtggaggcgtcaaacgtatctctggtcttatctacgaa gagactcgtggagtgctgaaagtgtttctggaaaatgtgatccgggacgcggtcacctat acggagcacgctaagcgcaagactgttaccgccatggatgtggtctacgcgctcaaacgt cagggccgtaccctttacggttttggtggttga

DBGET integrated database retrieval system