Bison bison bison (American bison): 104981880 Help Entry 104981880         CDS       T08726                                  Name (RefSeq) histone H2B type 1-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104981880  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104981880   09163 Immune disease    05322 Systemic lupus erythematosus     104981880   09165 Substance dependence    05034 Alcoholism     104981880  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104981880   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104981880 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104981880 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104981880 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF2428 Motif Other DBs NCBI-GeneID:  104981880 NCBI-ProteinID:  XP_010829435 UniProt:  A0A6P3GSI6 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MPKEVWITPKAMIRVDLNEQDMPEPAKSAPAPKKGSEKAVTKAQKKDGKKRKRSREESYS VHAYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASLLAHYNKYLTISSREIQTTI RLLLPGGLAKNAVSEGTKAVTKYTSSK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgccaaaggaggtgtggatcaccccgaaggccatgatccgggtggacctgaatgaacaa gacatgcctgaaccggctaagtctgctcctgcccctaaaaagggctctgaaaaagctgtg accaaggcccagaagaaggacggcaagaagcgcaagcgcagccgtgaggagagctactcc gtgcacgcgtacaaggtgctgaagcaagtccatccggacaccggcatctcgtccaaggcc atgggaatcatgaactccttcgtcaacgacattttcgagcgcatcgctggcgaggcatcg ctcctggcgcattacaacaagtacttgactatctcatccagggagatccagaccaccata cgcttgctgctacctggggggctggccaagaatgccgtgtccgagggcactaaggctgtc accaagtataccagctccaagtaa

DBGET integrated database retrieval system