Bison bison bison (American bison): 104982457 Help Entry 104982457         CDS       T08726                                  Symbol CD59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism bbis  Bison bison bison (American bison) Pathway bbis04610   Complement and coagulation cascades bbis04640   Hematopoietic cell lineage Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     104982457 (CD59)    04610 Complement and coagulation cascades     104982457 (CD59)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104982457 (CD59)    04090 CD molecules [BR:bbis04090]     104982457 (CD59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bbis00537]     104982457 (CD59) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104982457 (CD59)   Exosomal proteins of other body fluids (saliva and urine)    104982457 (CD59)   Exosomal proteins of colorectal cancer cells    104982457 (CD59) CD molecules [BR:bbis04090]  Proteins   104982457 (CD59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bbis00537]  Antigens   104982457 (CD59) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CD59 Toxin_TOLIP UPAR_LY6 Motif Other DBs NCBI-GeneID:  104982457 NCBI-ProteinID:  XP_010830136 Ensembl:  ENSBBBG00000012235 UniProt:  A0A6P3GKX4 LinkDB All DBs Position Unknown AA seq 121 aa AA seqDB search MASKGGYIVLGLLFLAVLCQLGHSLQCYSCINQVNCTSVVNCSHNQDACLFVKAVPLKFY HQCWKYEECSFEFIAKALGEKELHYDCCQKNLCNKSGGRSVSEKMLLLLTLLLEAVCHFY R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcaagcaaaggagggtacatcgtgcttgggctcctgttcctggctgtcctctgccaa ctcggtcacagcctgcagtgctacagctgtattaaccaagttaactgcacttcagtcgtc aattgttcacataatcaagatgcttgtctcttcgttaaggctgtgccgctaaaattttac caccagtgttggaagtacgaagaatgcagttttgagttcattgcaaaagccttaggggag aaggagctccactatgactgctgccagaagaacctgtgtaacaaaagtggcgggaggagc gtatccgagaagatgctgctgctgctcaccctgctgctggaggcagtctgccacttttat cgctaa

DBGET integrated database retrieval system