Bison bison bison (American bison): 104982837 Help Entry 104982837         CDS       T08726                                  Name (RefSeq) histone H2B type 1-J-like   KO K11252   histone H2B Organism bbis  Bison bison bison (American bison) Pathway bbis04613   Neutrophil extracellular trap formation bbis05034   Alcoholism bbis05203   Viral carcinogenesis bbis05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbis00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104982837  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104982837   09163 Immune disease    05322 Systemic lupus erythematosus     104982837   09165 Substance dependence    05034 Alcoholism     104982837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbis03036]     104982837   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbis04147]     104982837 Chromosome and associated proteins [BR:bbis03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104982837 Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104982837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_ABTB CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  104982837 NCBI-ProteinID:  XP_010830585 Ensembl:  ENSBBBG00000022030 UniProt:  A0A6P3GW12 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaagtctgctccggccccgaaaaagggctccaagaaggcggtgact aaggcgcagaagaaggacggcaagaagcgcaagcgcggccgcaaggaaagctactctatc tacgtgtacaaggtgctgaagcaagtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcctttgtgaacgacattttcgagcgcatcgcgggcgaggcatcgcgc ctggcgcattacaacaagcgctcgaccatcacttccagggagatccagacggccgtgcgc ctgttgctgcccggggagctggccaagcatgcggtgtccgagggcaccaaggccgtcacc aagtacactagtgccaagtaa

DBGET integrated database retrieval system