Bison bison bison (American bison): 104983162 Help Entry 104983162         CDS       T08726                                  Symbol CLDN5 Name (RefSeq) claudin-5   KO K06087   claudin Organism bbis  Bison bison bison (American bison) Pathway bbis03272   Virion - Hepatitis viruses bbis04382   Cornified envelope formation bbis04514   Cell adhesion molecule (CAM) interaction bbis04530   Tight junction bbis04670   Leukocyte transendothelial migration bbis05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104983162 (CLDN5)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104983162 (CLDN5)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104983162 (CLDN5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     104983162 (CLDN5)   09158 Development and regeneration    04382 Cornified envelope formation     104983162 (CLDN5)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     104983162 (CLDN5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbis03037]     104983162 (CLDN5)    04147 Exosome [BR:bbis04147]     104983162 (CLDN5) Cilium and associated proteins [BR:bbis03037]  Other cilia and associated proteins   Stereociliary proteins    104983162 (CLDN5) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104983162 (CLDN5)   Exosomal proteins of colorectal cancer cells    104983162 (CLDN5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  104983162 NCBI-ProteinID:  XP_010830932 UniProt:  A0A6P3GW75 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSPEVQAARALTVGAV LLALVALFVTLAGAQCTTCVAPGPAKARVALTGGALYALCGLLALVPLCWFANIVVREFY DPTVPMSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPDFSFPVKYSASRRPTA TGDYDKKNYV NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atgtggcaggtgacggccttcctggaccacaacatcgtgacggcgcagaccacctggaag gggctgtggatgtcgtgcgtggtgcagagcacagggcacatgcagtgcaaggtgtacgac tccgtgctggcgctgagccccgaggtgcaggcggcgcgggccctcaccgtgggcgccgtg ctgctggcgctcgtcgcgctgttcgtgaccctggcaggcgcccagtgcaccacctgcgtg gcccccggcccggccaaggcgcgcgtggcgctcacgggcggcgcgctctacgcgctctgc gggctgctggcgctggtgccgctctgctggttcgccaacatcgtggtccgcgagttctac gacccgaccgtgcccatgtctcagaagtacgagctgggagccgcgctctacattggctgg gccgcctcggcgctgctcatgtgcggcggcggcctcgtgtgctgcggcgcctgggtctgc accggccgcccggatttcagcttcccggtgaagtactcggcgtcgcggcggccgacggcc accggcgactatgacaagaagaactacgtctga

DBGET integrated database retrieval system