Bison bison bison (American bison): 104983685 Help Entry 104983685         CDS       T08726                                  Symbol CLDN2 Name (RefSeq) claudin-2   KO K06087   claudin Organism bbis  Bison bison bison (American bison) Pathway bbis03272   Virion - Hepatitis viruses bbis04382   Cornified envelope formation bbis04514   Cell adhesion molecules bbis04530   Tight junction bbis04670   Leukocyte transendothelial migration bbis05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bbis00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104983685 (CLDN2)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     104983685 (CLDN2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104983685 (CLDN2)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     104983685 (CLDN2)   09158 Development and regeneration    04382 Cornified envelope formation     104983685 (CLDN2)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     104983685 (CLDN2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbis03037]     104983685 (CLDN2)    04147 Exosome [BR:bbis04147]     104983685 (CLDN2)    04515 Cell adhesion molecules [BR:bbis04515]     104983685 (CLDN2) Cilium and associated proteins [BR:bbis03037]  Other cilia and associated proteins   Stereociliary proteins    104983685 (CLDN2) Exosome [BR:bbis04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104983685 (CLDN2)   Exosomal proteins of colorectal cancer cells    104983685 (CLDN2) Cell adhesion molecules [BR:bbis04515]  Immunoglobulin superfamily   L1 family    104983685 (CLDN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  104983685 NCBI-ProteinID:  XP_010831504 UniProt:  A0A6P3GX91 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MLLPSWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTMLGLPADIQAAQAMM VTSSAMSSLACIVSVVGMRCTVFFQESRAKDRVAVVGGVFFILGGLLGFIPVAWNLHGIL RDFYSPLVPDSMKFEIGEALYLGIISSLFSLQCAEGFDGNKGEQGFRKLLEAAEAVSIQV T NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atgctgctccccagctggcgaacaagctcctatgttggtgccagcattgtgactgcggtt ggcttctccaagggcctctggatggagtgtgcaacacacagcacaggcatcacccagtgt gacatctacagcaccatgctaggcctgcccgctgacatccaagctgcccaggccatgatg gtgacatccagcgccatgtcctccttggcatgcattgtctctgtggtgggcatgagatgc acagtcttcttccaggagtctcgagccaaagacagagtggcggttgtgggcggagtcttc ttcatccttggaggcctcctgggcttcattcctgttgcctggaatcttcacgggatcttg cgagacttctactccccgctggtgcctgacagcatgaaatttgagatcggagaggctctt tacctgggcattatttcctccctgttctccctgcaatgtgctgaaggctttgacggtaac aagggtgaacaagggttccggaaactgctggaagcagcagaggcagtgtccatccaggta acctga

DBGET integrated database retrieval system