Bison bison bison (American bison): 104984413 Help Entry 104984413         CDS       T08726                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism bbis  Bison bison bison (American bison) Pathway bbis04010   MAPK signaling pathway bbis04060   Cytokine-cytokine receptor interaction bbis04217   Necroptosis bbis04218   Cellular senescence bbis04380   Osteoclast differentiation bbis04640   Hematopoietic cell lineage bbis04932   Non-alcoholic fatty liver disease bbis04933   AGE-RAGE signaling pathway in diabetic complications bbis04940   Type I diabetes mellitus bbis05010   Alzheimer disease bbis05020   Prion disease bbis05022   Pathways of neurodegeneration - multiple diseases bbis05133   Pertussis bbis05140   Leishmaniasis bbis05152   Tuberculosis bbis05162   Measles bbis05164   Influenza A bbis05321   Inflammatory bowel disease bbis05323   Rheumatoid arthritis bbis05332   Graft-versus-host disease bbis05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104984413 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104984413 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104984413 (IL1A)    04218 Cellular senescence     104984413 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     104984413 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     104984413 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104984413 (IL1A)    05162 Measles     104984413 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     104984413 (IL1A)    05152 Tuberculosis     104984413 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     104984413 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     104984413 (IL1A)    05321 Inflammatory bowel disease     104984413 (IL1A)    05332 Graft-versus-host disease     104984413 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     104984413 (IL1A)    05020 Prion disease     104984413 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     104984413 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     104984413 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     104984413 (IL1A)    04932 Non-alcoholic fatty liver disease     104984413 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     104984413 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104984413 (IL1A) Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interleukins    104984413 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep DUF4937 Motif Other DBs NCBI-GeneID:  104984413 NCBI-ProteinID:  XP_010832415 Ensembl:  ENSBBBG00000004101 UniProt:  A0A6P3H1F0 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYTSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETS KTPKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSVHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQL PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSITDFQILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tacacttctgaaattgaccacctctctctcaatcagaagtccttctatgatgcaagctat gagccacttcgtgaggaccagatgaataagtttatgtccctggatacctcggaaacctct aagacacccaagcttagcttcaaggagaatgtggtgatggtggcagccagtgggaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt gccaataacacagaagaagaaatcatcaagcccagatcagtacattacagcttccagagt aatgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacctgacggctactacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt cctgtgactctgagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cccgtcttgctaaaggagatgcctgagacacccaaaatcatcaaagatgagaccaacctc ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag ttgtttattgccacaaagcaagaaaaattggtgcacatggcaagtgggccgccctcgatc actgactttcagatattggaaaaatag

DBGET integrated database retrieval system