Bison bison bison (American bison): 104984810 Help Entry 104984810         CDS       T08726                                  Name (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism bbis  Bison bison bison (American bison) Pathway bbis04060   Cytokine-cytokine receptor interaction bbis04151   PI3K-Akt signaling pathway bbis04217   Necroptosis bbis04620   Toll-like receptor signaling pathway bbis04621   NOD-like receptor signaling pathway bbis04622   RIG-I-like receptor signaling pathway bbis04623   Cytosolic DNA-sensing pathway bbis04630   JAK-STAT signaling pathway bbis04650   Natural killer cell mediated cytotoxicity bbis04936   Alcoholic liver disease bbis05152   Tuberculosis bbis05160   Hepatitis C bbis05161   Hepatitis B bbis05162   Measles bbis05163   Human cytomegalovirus infection bbis05164   Influenza A bbis05165   Human papillomavirus infection bbis05167   Kaposi sarcoma-associated herpesvirus infection bbis05168   Herpes simplex virus 1 infection bbis05169   Epstein-Barr virus infection bbis05170   Human immunodeficiency virus 1 infection bbis05171   Coronavirus disease - COVID-19 bbis05200   Pathways in cancer bbis05320   Autoimmune thyroid disease bbis05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbis00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     104984810    04151 PI3K-Akt signaling pathway     104984810   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104984810  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104984810  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104984810    04621 NOD-like receptor signaling pathway     104984810    04622 RIG-I-like receptor signaling pathway     104984810    04623 Cytosolic DNA-sensing pathway     104984810    04650 Natural killer cell mediated cytotoxicity     104984810  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     104984810   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     104984810    05161 Hepatitis B     104984810    05160 Hepatitis C     104984810    05171 Coronavirus disease - COVID-19     104984810    05164 Influenza A     104984810    05162 Measles     104984810    05168 Herpes simplex virus 1 infection     104984810    05163 Human cytomegalovirus infection     104984810    05167 Kaposi sarcoma-associated herpesvirus infection     104984810    05169 Epstein-Barr virus infection     104984810    05165 Human papillomavirus infection     104984810   09171 Infectious disease: bacterial    05152 Tuberculosis     104984810   09163 Immune disease    05320 Autoimmune thyroid disease     104984810   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     104984810   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     104984810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbis04052]     104984810 Cytokines and neuropeptides [BR:bbis04052]  Cytokines   Interferons    104984810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  104984810 NCBI-ProteinID:  XP_010833044 UniProt:  A0A6P3H1L3 LinkDB All DBs Position Unknown AA seq 158 aa AA seqDB search MAPAWSFLLALLLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNYFS FPQEALHGSQLQKAQAISVLHEVTQHTFQLFSTEGLAAVWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLTGDVHSTAACRVLEGTRVTPVTAADLFLP NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttcctcctggccctgctgctgctcagctgcaacgccatctgc tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaattacttctca ttcccccaggaggcgctgcatggcagccagttgcagaaggctcaggccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggcttggccgctgtgtgg gaccagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctcacgggtgacgttcacagcacagcagcctgcaga gtcctggaaggcacgagggtcactcccgtcacagctgcagacttgtttcttccttag

DBGET integrated database retrieval system