Bison bison bison (American bison): 104985226 Help Entry 104985226         CDS       T08726                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism bbis  Bison bison bison (American bison) Pathway bbis04360   Axon guidance bbis04666   Fc gamma R-mediated phagocytosis bbis04810   Regulation of actin cytoskeleton bbis05133   Pertussis bbis05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:bbis00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104985226 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     104985226 (CFL2)   09158 Development and regeneration    04360 Axon guidance     104985226 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     104985226 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     104985226 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbis04131]     104985226 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbis04812]     104985226 (CFL2)    04147 Exosome [BR:bbis04147]     104985226 (CFL2) Membrane trafficking [BR:bbis04131]  Others   Actin-binding proteins    Others     104985226 (CFL2) Cytoskeleton proteins [BR:bbis04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      104985226 (CFL2) Exosome [BR:bbis04147]  Exosomal proteins   Proteins found in most exosomes    104985226 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  104985226 NCBI-ProteinID:  XP_010833585 Ensembl:  ENSBBBG00000009594 UniProt:  A0A6P3H4Q8 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPL NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQV NGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaaggaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctc ttctgtttaagcgatgacaaaagacaaataattgttgaggaagcaaagcagatcttggtg ggtgacattggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctg aatgattgccgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaa gacctagtatttatattctgggctcctgaaagtgcgcctttaaaaagcaagatgatatat gctagctctaaagatgccattaaaaagaaatttacaggtataaaacatgagtggcaagta aatggcttggatgatataaaggaccgttccacacttggagagaaattgggaggcaatgta gtagtttcacttgaaggaaaacccttataa

DBGET integrated database retrieval system